ArtNr |
BM-RPC20686-50ug |
Hersteller |
Biomatik
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cell death protein RIP Receptor-interacting protein 1 Short name: RIP-1 Serine/threonine-protein kinase RIP RIP, RIP1 |
Similar products |
RIP1, Cell death protein RIP Receptor-interacting protein 1 Short name: RIP-1 Serine/threonine-protein kinase RIP RIP |
Lieferbar |
|
Gene Name |
RIPK1 |
Alternative Names |
Cell death protein RIP Receptor-interacting protein 1 Short name: RIP-1 Serine/threonine-protein kinase RIP RIP, RIP1 |
Uniprot |
Q13546 |
Source |
Baculovirus |
Expression Region |
1-375aa |
AA Sequence |
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCF HRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRL RHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLK AEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLK PENILVDNDFHIKIADLGLASFKMWSKLNNEEHNE LREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSD VYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGN RPDVDDITEYCPREIISLMKLCWEANPEARPTFPG IEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVV KRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG MGPVEESWFAPSLEHPQEENEPSLQ |
Sequence Info |
Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
46.4 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Serine-threonine kinase which transduces inflammatory and cell-death signals (programmed necrosis) following death receptors ligation, activation of pathogen recognition receptors (PRRs), and DNA damage. Upon activation of TNFR1 by the TNF-alpha family cytokines, TRADD and TRAF2 are recruited to the receptor. Phosphorylates DAB2IP at 'Ser-728' in a TNF-alpha-dependent manner, and thereby activates the MAP3K5-JNK apoptotic cascade. Ubiquitination by TRAF2 via 'Lys-63'-link chains acts as a critical enhancer of communication with downstream signal transducers in the mitogen-activated protein kinase pathway and the NF-kappa-B pathway, which in turn mediate downstream events including the activation of genes encoding inflammatory molecules. Polyubiquitinated protein binds to IKBKG/NEMO, the regulatory subunit of the IKK complex, a critical event for NF-kappa-B activation. Interaction with other cellular RHIM-containing adapters initiates gene activation and cell death. RIPK1 and RIPK3 association, in particular, forms a necrosis-inducing complex. |
Function |
Serine-threonine kinase which transduces inflammatory and cell-death signals (programmed necrosis) following death receptors ligation, activation of pathogen recognition receptors (PRRs), and DNA damage. Upon activation of TNFR1 by the TNF-alpha family cytokines, TRADD and TRAF2 are recruited to the receptor. Phosphorylates DAB2IP at 'Ser-728' in a TNF-alpha-dependent manner, and thereby activates the MAP3K5-JNK apoptotic cascade. Ubiquitination by TRAF2 via 'Lys-63'-link chains acts as a critical enhancer of communication with downstream signal transducers in the mitogen-activated protein kinase pathway and the NF-kappa-B pathway, which in turn mediate downstream events including the activation of genes encoding inflammatory molecules. Polyubiquitinated protein binds to IKBKG/NEMO, the regulatory subunit of the IKK complex, a critical event for NF-kappa-B activation. Interaction with other cellular RHIM-containing adapters initiates gene activation and cell death. RIPK1 and RIPK3 association, in particular, forms a necrosis-inducing complex. |
Subcellular location |
Cytoplasm, Cell membrane |
Protein Families |
Protein kinase superfamily, TKL Ser/Thr protein kinase family |
Paythway |
NF-kappaBsignalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.