Vergleich

Recombinant Human Serine/threonine-protein kinase PLK1 (PLK1), partial

ArtNr BM-RPC20650-50ug
Hersteller Biomatik
Menge 50 UG
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Sequence MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAP PAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEI SDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIH RSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLE LHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHR DLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKT LCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLL VGK
Protein Familie Protein kinase superfamily, Ser/Thr protein kinase family, CDC5/Polo subfamily
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Polo-like kinase 1 Short name: PLK-1 Serine/threonine-protein kinase 13 Short name: STPK13
Similar products Polo-like kinase 1 Short name: PLK-1 Serine/threonine-protein kinase 13 Short name: STPK13
Lieferbar
Manufacturer - Conjugate / Tag
Unconjugated, N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged
Shipping Temperature
Ice packs
Storage Conditions
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)
70.3 kDa
Expression Region
1-603aa
Restrictions
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration
1 year
Endotoxin
Not Tested
Relevance
Activated by phosphorylation of Thr-210 by AURKA; phosphorylation by AURKA is enhanced by BORA. Once activated, activity is stimulated by binding target proteins. Binding of target proteins has no effect on the non-activated kinase. Several inhibitors targeting PLKs are currently in development and are under investigation in a growing number of clinical trials, such as BI 2536, an ATP-competitive PLK1 inhibitor or BI 6727, a dihydropteridinone that specifically inhibits the catalytic activity of PLK1.
Subcellular location
Nucleus, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, spindle, Midbody
Involvement in disease
Defects in PLK1 are associated with some cancers, such as gastric, thyroid or B-cell lymphomas. Expression is cancer increased in tumor tissues with a poor prognosis, suggesting a role in malignant transformations and carcinogenesis.
Function
Serine/threonine-protein kinase that performs several important functions throughout M phase of the cell cycle, including the regulation of centrosome maturation and spindle assembly, the removal of cohesins from chromosome arms, the inactivation of anaphase-promoting complex/cyclosome (APC/C) inhibitors, and the regulation of mitotic exit and cytokinesis. Polo-like kinase proteins acts by binding and phosphorylating proteins are that already phosphorylated on a specific motif recognized by the POLO box domains. Phosphorylates BORA, BUB1B/BUBR1, CCNB1, CDC25C, CEP55, ECT2, ERCC6L, FBXO5/EMI1, FOXM1, KIF20A/MKLP2, CENPU, NEDD1, NINL, NPM1, NUDC, PKMYT1/MYT1, KIZ, PPP1R12A/MYPT1, PRC1, RACGAP1/CYK4, SGO1, STAG2/SA2, TEX14, TOPORS, p73/TP73, TPT1, WEE1 and HNRNPU. Plays a key role in centrosome functions and the assembly of bipolar spindles by phosphorylating KIZ, NEDD1 and NINL. NEDD1 phosphorylation promotes subsequent targeting of the gamma-tubulin ring complex (gTuRC) to the centrosome, an important step for spindle formation. Phosphorylation of NINL component of the centrosome leads to NINL dissociation from other centrosomal proteins. Involved in mitosis exit and cytokinesis by phosphorylating CEP55, ECT2, KIF20A/MKLP2, CENPU, PRC1 and RACGAP1. Recruited at the central spindle by phosphorylating and docking PRC1 and KIF20A/MKLP2; creates its own docking sites on PRC1 and KIF20A/MKLP2 by mediating phosphorylation of sites subsequently recognized by the POLO box domains. Phosphorylates RACGAP1, thereby creating a docking site for the Rho GTP exchange factor ECT2 that is essential for the cleavage furrow formation. Promotes the central spindle recruitment of ECT2. Plays a central role in G2/M transition of mitotic cell cycle by phosphorylating CCNB1, CDC25C, FOXM1, CENPU, PKMYT1/MYT1, PPP1R12A/MYPT1 and WEE1. Part of a regulatory circuit that promotes the activation of CDK1 by phosphorylating the positive regulator CDC25C and inhibiting the negative regulators WEE1 and PKMYT1/MYT1. Also acts by mediating phosphorylation of cyclin-B1 (CCNB1) on centrosomes in prophase. Phosphorylates FOXM1, a key mitotic transcription regulator, leading to enhance FOXM1 transcriptional activity. Involved in kinetochore functions and sister chromatid cohesion by phosphorylating BUB1B/BUBR1, FBXO5/EMI1 and STAG2/SA2. PLK1 is high on non-attached kinetochores suggesting a role of PLK1 in kinetochore attachment or in spindle assembly checkpoint (SAC) regulation. Required for kinetochore localization of BUB1B. Regulates the dissociation of cohesin from chromosomes by phosphorylating cohesin subunits such as STAG2/SA2. Phosphorylates SGO1
Activity
Not Tested
Tissue Specificity
Placenta and colon.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Pathway
Cellcycle
Manufacturer - Gene Name
PLK1
Sequence Information
Extracellular Domain

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 UG
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen