ArtNr |
BM-RPC20617-50ug |
Hersteller |
Biomatik
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Agammaglobulinemia tyrosine kinase Short name: ATK B-cell progenitor kinase Short name: BPK Bruton tyrosine kinase AGMX1 |
Similar products |
Agammaglobulinemia tyrosine kinase Short name: ATK B-cell progenitor kinase Short name: BPK Bruton tyrosine kinase AGMX1 |
Lieferbar |
|
Gene Name |
BTK |
Alternative Names |
Agammaglobulinemia tyrosine kinase Short name: ATK B-cell progenitor kinase Short name: BPK Bruton tyrosine kinase AGMX1 |
Uniprot |
Q06187 |
Source |
Baculovirus |
Expression Region |
1-659aa |
AA Sequence |
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVH KLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPE KNPPPERQIPRRGEESSEMEQISIIERFPYPFQVV YDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQ KYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSL KPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAP VSTSELKKVVALYDYMPMNANDLQLRKGDEYFILE ESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYE WYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKY TVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKH LFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAP STAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHE KLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMR HRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAAR NCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFP VRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGK MPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIM YSCWHEKADERPTFKILLSNILDVMDEES |
Sequence Info |
Full Length of Isoform BTK-A |
Tag Info |
N-terminal 10xHis-tagged |
Theoretical MW |
78.3 kDa |
Purity |
>90% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis. |
Function |
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis. |
Involvement in disease |
X-linked agammaglobulinemia (XLA); X-linked hypogammaglobulinemia and isolated growth hormone deficiency (XLA-IGHD) |
Subcellular location |
Cytoplasm, Cell membrane, Peripheral membrane protein, Nucleus |
Protein Families |
Protein kinase superfamily, Tyr protein kinase family, TEC subfamily |
Tissue Specificity |
Predominantly expressed in B-lymphocytes. |
Paythway |
NF-kappaBsignalingpathway |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.