« Zurück
Home /
Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)

Recombinant Bovine Adrenodoxin, mitochondrial (FDX1)

ArtNr	BM-RPC26035-50ug
Hersteller	Biomatik
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Bovine
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)
Similar products	Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)
Lieferbar
Gene Name	FDX1
Alternative Names	Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)
Uniprot	P00257
Source	Yeast
Expression Region	59-186aa
AA Sequence	SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQ NNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAI TDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTV RVPDAVSDARESIDMGMNSSKIE
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	15.3 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Essential for the synthesis of various steroid hormones. Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage to produce pregnenolone, the precursor of most steroid hormones. Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons.
Function	Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (By similarity).
Subcellular location	Mitochondrion matrix
Protein Families	Adrenodoxin/putidaredoxin family
Tissue Specificity	Detected in adrenal cortex and corpus luteum (at protein level).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 30.08.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail