« Zurück
Home /
DCBLD1 antibody - N-terminal region (ARP55687_P050)

DCBLD1 antibody - N-terminal region (ARP55687_P050)

ArtNr	ARP55687_P050
Hersteller	AVIVA Systems Biology
Menge	50ug
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Lyophilized powder
Applikationen	WB
Specific against	Human, Mouse, Rat, Porcine, Rabbit, Guinea Pig, Bovine, Canine, Equine
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DKFZp686L21135, MGC46341, dJ94G16.1
Similar products	DCBLD1
Lieferbar
Description	This is a rabbit polyclonal antibody against DCBLD1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (mailto:infohoelzel.de'>infohoelzel.de).
Gene symbol	DCBLD1
Alias symbols	DKFZp686L21135, MGC46341, dJ94G16.1
Protein size	539
Molecular weight	59kDa
Gene_id	285761
Peptide Sequence	TITVPKGKRLILRLGDLDIESQTCASDYLLFTSSS DQYGPYCGSMTVPKE
Reconstitution and storage	Add 50 ul of distilled water. Final anti-DCBLD1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Description of target	The specific function of the protein remains unknown.
Homology short	Bovine, Horse, Human, Pig, Rat, Dog, Rabbit, Guinea pig, Chicken
Purification	Affinity Purified
Immunogen	The immunogen for anti-DCBLD1 antibody: synthetic peptide directed towards the N terminal of human DCBLD1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Lieferung vsl. bis 30.08.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail