« Zurück
Home /
Anti-LHX6 Antibody

Anti-LHX6 Antibody

ArtNr	ANTI-A92140-50
Hersteller	Antibodies.com
Menge	50ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Applikationen	IF
Specific against	Human
Host	Rabbit
Isotype	IgG
Sequence	NKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Product Description	Rabbit polyclonal antibody to LHX6.
Clonality	Polyclonal
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 143-392 of human LHX6 (NP_055183.2).
Formulation	Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	IF: 1:50-1:200
Target	LHX6

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 23.08.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern