« Zurück
Home /
Anti-ARAF Antibody

Anti-ARAF Antibody

ArtNr	ANTI-A91866-100
Hersteller	Antibodies.com
Menge	100ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Applikationen	WB, IF
Specific against	Human, Mouse
Host	Rabbit
Isotype	IgG
Sequence	GFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP
ECLASS 5.1	32160702
ECLASS 6.1	32160702
ECLASS 8.0	32160702
ECLASS 9.0	32160702
ECLASS 10.0.1	32160702
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Product Description	Rabbit polyclonal antibody to ARAF.
Clonality	Polyclonal
Immunogen	Recombinant funsion protein containing a sequence corresponding to amino acids 371-606 of human ARAF (NP_001645.1).
Formulation	Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2000, IF: 1:50-1:200
Target	ARAF

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail