« Zurück
Home /
Anti-CD254 Antibody [C01-2D2]

Anti-CD254 Antibody [C01-2D2]

ArtNr	ANTI-A279927-100
Hersteller	Antibodies.com
Menge	100ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Liquid
Applikationen	ELISA
Clon	C01-2D2
Specific against	Human
Host	Mouse
Isotype	IgG2b
Konjugat/Tag	Unconjugated
Sequence	EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Specificity	This antibody recognises CD254 also known as RANKL and TNFSF11. CD254 is a ~20 kDa glycoprotein, a member of the tumour necrosis factor (TNF) superfamily. CD254 is a ligand for the receptor activator of NF?B (RANK) and this interaction plays a role in ost
Product Description	Mouse monoclonal [C01-2D2] antibody to RANKL.
Clonality	Monoclonal
Immunogen	E. coli derived recombinant protein corresponding to amino acids 143-317 of human CD254.
Concentration	1 mg/ml
Product form	Liquid
Formulation	Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.
Protein Length	175
Amino acids	aa 143 - 317
Purification	Protein G affinity chromatography of ascites.
Storage	Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
Target	RANKL

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail