« Zurück
Home /
Anti-TXN Antibody

Anti-TXN Antibody

ArtNr	ANTI-A15819-50
Hersteller	Antibodies.com
Menge	50ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Liquid
Applikationen	WB, IP, IHC, ICC
Specific against	Human, Mouse
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Sequence	DKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Lieferbar
Product Description	Rabbit polyclonal antibody to Thioredoxin / TRX.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Product form	Liquid
Molecular weight	12 kDa
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	WB: 1:500-1:2, 000, IHC: 1:100-1:500, ICC/IF: 1:50-1:200, IP: 1:20-1:50
Target	Thioredoxin / TRX

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail