« Zurück
Home /
Anti-CD46 Picoband Antibody

Anti-CD46 Picoband Antibody

ArtNr	ABC-ABO12534
Hersteller	Abcepta
Menge	100 ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Lyophilized
Applikationen	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	CD46, Cd46, Membrane cofactor protein, Mcp
Lieferbar
Primary Accession	O88174
Application	WB
Clonality	Polyclonal
Gene ID	17221
Reactivity	M
Legend image 1	Western blot analysis of CD46 expression in mouse testis extract (lane 1) and NIH3T3 whole cell lysates (lane 2). CD46 at 41KD, 70KD was detected using rabbit anti- CD46 Antigen Affinity purified polyclonal antibody (Catalog # ABO12534) at0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	40881
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Membrane cofactor protein(CD46) detection. Tested with WB in Mouse.
Protein Function	May be involved in the fusion of the spermatozoa with the oocyte during fertilization. .
Subcellular Localization	Isoform 1: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Inner acrosomal membrane of spermatozoa.
Tissue Specificity	Present only in testis (at protein level). .
Protein Name	Membrane cofactor protein
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins.
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

ABC-ABO12534-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.11.2024

Express-Lieferung: 29 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail