ArtNr |
ABC-ABO12534 |
Hersteller |
Abcepta
|
Menge |
100 ug |
Kategorie |
|
Typ |
Antibody Primary |
Format |
Lyophilized |
Applikationen |
WB |
Specific against |
other |
Host |
Rabbit |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Similar products |
CD46, Cd46, Membrane cofactor protein, Mcp |
Lieferbar |
|
Primary Accession |
O88174 |
Application |
WB |
Clonality |
Polyclonal |
Gene ID |
17221 |
Reactivity |
M |
Legend image 1 |
Western blot analysis of CD46 expression in mouse testis extract (lane 1) and NIH3T3 whole cell lysates (lane 2). CD46 at 41KD, 70KD was detected using rabbit anti- CD46 Antigen Affinity purified polyclonal antibody (Catalog # ABO12534) at0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method . |
Type image 1 |
WB |
Dilution image 1 |
0.1-0.5 µg/ml |
Calculated MW |
40881 |
Reconstitution |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Description |
Rabbit IgG polyclonal antibody for Membrane cofactor protein(CD46) detection. Tested with WB in Mouse. |
Protein Function |
May be involved in the fusion of the spermatozoa with the oocyte during fertilization. . |
Subcellular Localization |
Isoform 1: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Inner acrosomal membrane of spermatozoa. |
Tissue Specificity |
Present only in testis (at protein level). . |
Protein Name |
Membrane cofactor protein |
Contents |
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids. |
Purification |
Immunogen affinity purified. |
Cross Reactivity |
No cross reactivity with other proteins. |
Storage |
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing. |
Concentration (mg/ml) |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.