ArtNr |
ABC-ABO12129 |
Hersteller |
Abcepta
|
Menge |
100 ug |
Kategorie |
|
Typ |
Antibody Primary |
Format |
Lyophilized |
Applikationen |
WB, IHC-P |
Specific against |
other |
Host |
Rabbit |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Similar products |
SLUG, SNAI2, SLUGH, Neural crest transcription factor Slug, Protein snail homolog 2, Zinc finger protein SNAI2 |
Lieferbar |
|
Primary Accession |
O43623 |
Application |
WB, IHC-P |
Clonality |
Polyclonal |
Gene ID |
6591 |
Reactivity |
H, M, Rat |
Legend image 1 |
Anti- SLUG Picoband antibody, ABO12129, Western blottingAll lanes: Anti SLUG (ABO12129) at 0.5ug/mlLane 1: Mosue Kidney Tissue Lysate at 50ugLane 2: Mouse Lung Tissue Lysate at 50ugLane 3: Mouse Spleen Tissue Lysate at 50ugLane 4: Mouse Brain Tissue Lysate at 50ugLane 5: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 30KDObserved bind size: 39KD |
Type image 1 |
WB |
Dilution image 1 |
0.1-0.5 µg/ml |
Legend image 2 |
Anti- SLUG Picoband antibody, ABO12129, IHC(P)IHC(P): Mouse Cardiac Muscle Tissue |
Type image 2 |
IHC |
Dilution image 2 |
0.5-1 µg/ml |
Legend image 3 |
Anti- SLUG Picoband antibody, ABO12129, IHC(P)IHC(P): Rat Cardiac Muscle Tissue |
Type image 3 |
IHC |
Calculated MW |
29986 |
Reconstitution |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Description |
Rabbit IgG polyclonal antibody for Zinc finger protein SNAI2(SNAI2) detection. Tested with WB, IHC-P in Human; Mouse; Rat. |
Protein Function |
Transcriptional repressor that modulates both activator- dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1- induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells (By similarity). Represses BRCA2 expression by binding to its E2- box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis. . |
Subcellular Localization |
Nucleus. Cytoplasm. Observed in discrete foci in interphase nuclei. These nuclear foci do not overlap with the nucleoli, the SP100 and the HP1 heterochromatin or the coiled body, suggesting SNAI2 is associated with active transcription or active splicing regions. |
Tissue Specificity |
Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level). . |
Protein Name |
Zinc finger protein SNAI2 |
Contents |
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences. |
Purification |
Immunogen affinity purified. |
Cross Reactivity |
No cross reactivity with other proteins |
Storage |
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing. |
Concentration (mg/ml) |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Sequence Similarities |
Belongs to the snail C2H2-type zinc-finger protein family. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.