« Zurück
Home /
Anti-Peptide YY Picoband Antibody

Anti-Peptide YY Picoband Antibody

ArtNr	ABC-ABO11632
Hersteller	Abcepta
Menge	100 ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Lyophilized
Applikationen	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	Peptide YY, Pyy
Lieferbar
Primary Accession	Q9EPS2
Application	WB
Clonality	Polyclonal
Gene ID	217212
Reactivity	M
Legend image 1	Western blot analysis of Peptide YY expression in mouse spleen extract (lane 1) and mouse liver extract (lane 2). Peptide YY at 19KD was detected using rabbit anti- Peptide YY Antigen Affinity purified polyclonal antibody (Catalog # ABO11632) at 0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	11064
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Peptide YY(PYY) detection. Tested with WB in Mouse.
Protein Function	This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Subcellular Localization	Secreted.
Protein Name	Peptide YY
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

ABC-ABO11632-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.11.2024

Express-Lieferung: 29 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail