ArtNr |
ABC-ABO10312 |
Hersteller |
Abcepta
|
Menge |
100 ug |
Kategorie |
|
Typ |
Antibody Primary |
Format |
Lyophilized |
Applikationen |
WB |
Specific against |
other |
Host |
Rabbit |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Similar products |
ANXA7, Annexin A7, ANX7, SNX, Annexin VII, Annexin-7, Synexin |
Lieferbar |
|
Primary Accession |
P20073 |
Application |
WB |
Clonality |
Polyclonal |
Gene ID |
310 |
Reactivity |
H |
Legend image 1 |
Western blot analysis of Annexin VII expression in JURKAT whole cell lysates (lane 1). Annexin VII at 52KD was detected using rabbit anti- Annexin VII Antigen Affinity purified polyclonal antibody (Catalog # ABO10312) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method . |
Type image 1 |
WB |
Dilution image 1 |
0.1-0.5 µg/ml |
Calculated MW |
52739 |
Reconstitution |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Description |
Rabbit IgG polyclonal antibody for Annexin A7(ANXA7) detection. Tested with WB in Human. |
Protein Function |
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. |
Tissue Specificity |
Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. . |
Protein Name |
Annexin A7 |
Contents |
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid. |
Purification |
Immunogen affinity purified. |
Cross Reactivity |
No cross reactivity with other proteins. |
Storage |
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing. |
Concentration (mg/ml) |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.