« Zurück
Home /
Anti-Annexin VII Picoband Antibody

Anti-Annexin VII Picoband Antibody

ArtNr	ABC-ABO10312
Hersteller	Abcepta
Menge	100 ug
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Primary
Format	Lyophilized
Applikationen	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	ANXA7, Annexin A7, ANX7, SNX, Annexin VII, Annexin-7, Synexin
Lieferbar
Primary Accession	P20073
Application	WB
Clonality	Polyclonal
Gene ID	310
Reactivity	H
Legend image 1	Western blot analysis of Annexin VII expression in JURKAT whole cell lysates (lane 1). Annexin VII at 52KD was detected using rabbit anti- Annexin VII Antigen Affinity purified polyclonal antibody (Catalog # ABO10312) at 0.5 Î¼g/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	52739
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Annexin A7(ANXA7) detection. Tested with WB in Human.
Protein Function	Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Tissue Specificity	Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. .
Protein Name	Annexin A7
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins.
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

ABC-ABO10312-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 04.10.2024

Express-Lieferung: 15 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail