« Zurück
Home /
p70 S6 Kinase 2 Rabbit mAb

p70 S6 Kinase 2 Rabbit mAb

ArtNr	A9100-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Oncology Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Primary Antibodies Astrocytoma
Typ	Antibody Primary
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NCBI	RPS6KB2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KLS, P70-beta, P70-beta-1, P70-beta-2, S6K-beta2, S6K2, SRK, STK14B, p70(S6K)-beta, p70S6Kb
Lieferbar
Background	This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human p70 S6 Kinase 2 (Q9UBS0).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	53kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Signal Transduction, Kinase, Serine threonine kinases, PI3K-Akt Signaling Pathway, mTOR Signaling Pathway, ErbB-HER Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, TGF-b-Smad Signaling Pathway, Endocrine Metabolism, AMPK Signaling Pathway, Insulin Receptor Signaling Pathway, Endocrine and metabolic diseases, Diabetes, Obesity, Immunology Inflammation, B Cell Receptor Signaling Pathway, Cardiovascular, Angiogenesis
Gene Symbol	RPS6KB2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail