Vergleich

Caspase-9 Rabbit mAb Europäischer Partner

ArtNr A4919-1000uL
Hersteller Abclonal
Menge 1000 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSK
NCBI CASP9
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias MCH6; APAF3; APAF-3; PPP1R56; ICE-LAP6
Lieferbar
Background
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein can undergo autoproteolytic processing and activation by the apoptosome, a protein complex of cytochrome c and the apoptotic peptidase activating factor 1; this step is thought to be one of the earliest in the caspase activation cascade. This protein is thought to play a central role in apoptosis and to be a tumor suppressor. Alternative splicing results in multiple transcript variants.
Route
Synthetic Peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Caspase-9 (P55211).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
46kDa
Manufacturers Research Area
Signal Transduction, ErbB-HER Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Caspases, Mitochondrial Control of Apoptosis, Inhibition of Apoptosis, Death Receptor Signaling Pathway, Immunology Inflammation, Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease
Gene Symbol
CASP9

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen