ArtNr |
A4084-100ul |
Hersteller |
Abclonal
|
Menge |
100ul |
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
WB, FC, ELISA |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
NCBI |
CD48 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48 |
Similar products |
SLAMF2, BCM1, BLAST, BLAST1, MEM-102, hCD48, mCD48 |
Lieferbar |
|
Background |
This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48 (NP_001769.2). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:2000 - 1:20000|FC, 1:50 - 1:200 |
Protein Size |
19kDa/27kDa |
Manufacturers Research Area |
Immunology Inflammation, CDs |
Gene Symbol |
CD48 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.