« Zurück
Home /
PON1 Rabbit mAb

PON1 Rabbit mAb

ArtNr	A3441-100ul
Hersteller	Abclonal
Menge	100ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEE
NCBI	PON1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ESA, MVCD5, PON
Lieferbar
Background	This gene encodes a member of the paraoxonase family of enzymes and exhibits lactonase and ester hydrolase activity. Following synthesis in the kidney and liver, the enzyme is secreted into the circulation, where it binds to high density lipoprotein (HDL) particles and hydrolyzes thiolactones and xenobiotics, including paraoxon, a metabolite of the insecticide parathion. Polymorphisms in this gene may be associated with coronary artery disease and diabetic retinopathy. The gene is found in a cluster of three related paraoxonase genes on chromosome 7.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PON1 (P27169).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	40kDa
Manufacturers Research Area	Signal Transduction, Cell Biology Developmental Biology, Endocrine Metabolism, Lipid Metabolism, Drug metabolism, Endocrine and metabolic diseases, Diabetes, Neuroscience, Neurodegenerative Diseases, Dopamine Signaling in Parkinson's Disease, Cardiovascular, Lipids
Gene Symbol	PON1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail