ArtNr |
A23853-200T |
Hersteller |
Abclonal
|
Menge |
200 T |
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
FC |
Specific against |
Human |
Isotype |
IgG |
Konjugat/Tag |
ABflo® 647. Ex:656nm. Em:670nm. |
Purity |
Affinity purification |
Sequence |
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE |
NCBI |
TNFRSF1B |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
TNFRSF10B; CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9; TNF receptor superfamily member 10b |
Lieferbar |
|
Background |
The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 56-182 of human CD262/DR5/TRAILR2. |
Storage |
Store at 2-8℃. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Recommended Dilution |
FC, 5 μl per 10^6 cells in 100 μl volume |
Protein Size |
12kDa/45kDa/47kDa |
Manufacturers Research Area |
Cancer, Signal Transduction, Cell Biology & Developmental Biology, Apoptosis, Growth factor, TNF, Death Receptor Signaling Pathway, Immunology & Inflammation, CD markers, NF-kB Signaling Pathway, |
Gene Symbol |
TNFRSF10B |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.