ArtNr |
A22734-100uL |
Hersteller |
Abclonal
|
Menge |
100 uL |
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
WB, IF, ICC, ELISA |
Specific against |
Human |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
NCBI |
SUMO2 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
HSMT3; SMT3B; SUMO3; Smt3A; SMT3H2 |
Lieferbar |
|
Background |
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant protein of human SUMO2/3. |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IF/ICC, 1:100 - 1:500 |
Protein Size |
11kDa |
Manufacturers Research Area |
Cell Biology Developmental Biology, Ubiquitin, Endocrine Metabolism, Mitochondrial metabolism, Immunology Inflammation, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway |
Gene Symbol |
SUMO2 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.