Vergleich

ABflo® 488 Rabbit anti-Human CD59 mAb Europäischer Partner

ArtNr A22588-500T
Hersteller Abclonal
Menge 500 T
Kategorie
Typ Antibody Monoclonal
Applikationen FC
Specific against Human
Isotype IgG
Konjugat/Tag ABflo® 488. Ex:491nm. Em:516nm.
Purity Affinity purification
Sequence LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLE
NCBI CD59
ECLASS 5.1 32160702
ECLASS 6.1 32160702
ECLASS 8.0 32160702
ECLASS 9.0 42030590
ECLASS 10.0.1 42030590
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
Lieferbar
Background
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.
Route
Recombinant protein
Manufacturers Category
Monoclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 26-101 of human CD59 (NP_000602.1).
Storage
Store at 2-8℃. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
14kDa
Manufacturers Research Area
Signal Transduction, Kinase, Tyrosine kinases, Immunology Inflammation, CDs, Cell Intrinsic Innate Immunity Signaling Pathway, Stem Cells, Hematopoietic Progenitors, Cardiovascular
Gene Symbol
CD59

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 T
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen