ArtNr |
A22418-200uL |
Hersteller |
Abclonal
|
Menge |
200 uL |
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
WB, IF, ICC, ELISA |
Specific against |
Human |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP |
NCBI |
RPS6 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
S6; eS6 |
Lieferbar |
|
Background |
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human S6 Ribosomal Protein (RPS6) (NP_001001.2). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200 |
Protein Size |
29kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, RNA Binding, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Protein phosphorylation, Signal Transduction, PI3K-Akt Signaling Pathway, MAPK-Erk Signaling Pathway |
Gene Symbol |
RPS6 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.