ArtNr |
A22330-300uL |
Hersteller |
Abclonal
|
Menge |
300 uL |
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
WB, ELISA |
Specific against |
Human |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE |
NCBI |
FGF2 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
BFGF; FGFB; FGF-2; HBGF-2 |
Lieferbar |
|
Background |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. |
Route |
Synthetic peptide |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000 |
Protein Size |
17kDa/21kDa/22kDa/30kDa |
Manufacturers Research Area |
Cancer, Invasion and Metastasis, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Neuroscience, Stem Cells, Neural Stem Cells, Cardiovascular, Angiogenesis |
Gene Symbol |
FGF2 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.