« Zurück
Home /
ABflo® 647 Rabbit anti-Human CD5 mAb

ABflo® 647 Rabbit anti-Human CD5 mAb

ArtNr	A22186-200T
Hersteller	Abclonal
Menge	200 T
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	FC
Specific against	Human
Isotype	IgG
Konjugat/Tag	ABflo® 647. Ex:656nm. Em:670nm.
Purity	Affinity purification
Sequence	RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLV
NCBI	CD5
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	T1; LEU1
Lieferbar
Background	This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-371 of human CD5 (NP_055022.2).
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	55kDa
Manufacturers Research Area	Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, CDs, Stem Cells, Hematopoietic Progenitors
Gene Symbol	CD5

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 T

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 21 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail