Vergleich

FGF8 Rabbit pAb Europäischer Partner

ArtNr A20814-200uL
Hersteller Abclonal
Menge 200 uL
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Human
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence NNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
NCBI FGF8
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias HH6; AIGF; KAL6; FGF-8; HBGF-8
Lieferbar
Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants.
Route
Recombinant Protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 165-244 of human FGF8 (NP_149353.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
27kDa
Manufacturers Research Area
Cancer, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Stem Cells, Mesenchymal Stem Cells, Cardiovascular, Angiogenesis
Gene Symbol
FGF8

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen