ArtNr |
A20379-50ul |
Hersteller |
Abclonal
|
Menge |
50ul |
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
WB, IP, ELISA, IHC-P, CHIP, Dot |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
NCBI |
Histone H3 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
H3.4;H3/g;H3FT;H3t;HIST3H3;Histone H3;HIST1H3A |
Lieferbar |
|
Background |
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3. |
Route |
Synthetic peptide |
Manufacturers Category |
Methylated Antibodies |
Immunogen |
A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
DB, 1:500 - 1:1000|WB, 1:500 - 1:1000|IP, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|ChIP, 1:50 - 1:200|ChIP-seq, 1:50 - 1:100 |
Protein Size |
15kDa |
Manufacturers Research Area |
Signal Transduction, MAPK-Erk Signaling Pathway, MAPK-P38 Signaling Pathway, Epigenetics & Nuclear Signaling, Epigenetic Modifications, Methylation |
Gene Symbol |
Histone H3 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.