« Zurück
Home /
IGHD Rabbit mAb

IGHD Rabbit mAb

ArtNr	A19708-50ul
Hersteller	Abclonal
Menge	50ul
Kategorie	Oncology Antibodies By Cell Type Hematology Leukemia Lymphoma Myeloma Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEIQRRDSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRW
NCBI	IGHD
ECLASS 5.1	32160702
ECLASS 6.1	32160702
ECLASS 8.0	32160702
ECLASS 9.0	42030590
ECLASS 10.0.1	42030590
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Lieferbar
Background	Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in positive regulation of interleukin-1 production. Located in blood microparticle and extracellular exosome.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IGHD (P01880).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	42kDa
Manufacturers Research Area	Immunology Inflammation, Stem Cells, Hematopoietic Progenitors
Gene Symbol	IGHD

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail