« Zurück
Home /
Fetuin A/AHSG Rabbit mAb

Fetuin A/AHSG Rabbit mAb

ArtNr	A19264-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARC
NCBI	AHSG
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	AHSG; A2HS; AHS; FETUA; HSGA; alpha-2-HS-glycoprotein
Similar products	AHSG, FETUA, A2HS, AHS, HSGA, alpha-2-HS-glycoprotein
Lieferbar
Background	The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness.
Route	Synthetic peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fetuin A/AHSG (P02765).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	39kDa
Manufacturers Research Area	Endocrine Metabolism, Endocrine and metabolic diseases, Obesity, Neuroscience, Cardiovascular, Blood, Serum Proteins
Gene Symbol	AHSG

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 24 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail