ArtNr |
A18800-50ul |
Hersteller |
Abclonal
|
Menge |
50ul |
Kategorie |
|
Typ |
Antibody Primary |
Applikationen |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Purity |
Affinity purification |
Sequence |
GSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYR |
NCBI |
PKM |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
PK3; TCB; p58; OIP3; PKM2; CTHBP; THBP1; |
Lieferbar |
|
Background |
This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported. |
Route |
Synthetic peptide |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PKM1-specific (NP_001193728.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
58kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, RNA Binding, Protein phosphorylation, Cancer, Tumor biomarkers, Signal Transduction, Endocrine Metabolism, Carbohydrate metabolism, Warburg Effect |
Gene Symbol |
PKM |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.