« Zurück
Home /
IL23A Rabbit pAb

IL23A Rabbit pAb

ArtNr	A1750-200uL
Hersteller	Abclonal
Menge	200 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB
Specific against	Human
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
NCBI	IL23A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P19; SGRF; IL-23; IL-23A; IL23P19
Lieferbar
Background	This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-189 of human IL23A (NP_057668.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	21kDa
Manufacturers Research Area	Cancer, Tumor immunology, Immunology Inflammation, Cytokines, Interleukins, Cell Intrinsic Innate Immunity Signaling Pathway
Gene Symbol	IL23A

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 uL

lieferbar

Lieferung vsl. bis 27.09.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern