« Zurück
Home /
HSF2BP Rabbit pAb

HSF2BP Rabbit pAb

ArtNr	A10603-50uL
Hersteller	Abclonal
Menge	50 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Mouse
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAATVGDGSGTEEACRNMESKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGELLESFQKLKMVEKNLERKEQELEQLIMDREHFKARLETAQADSGREKKEKLALRQQLNEAKQQLLQQAEYCTQMGAVTCTLLWGVSSSEEVVKTILGGDKALKFFNITGQTMESFVKSLDGDVKEVDSDENQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTMLQLLGDLKPGQCTKLKVLMLMSLYNVSINSKGLKYIT
NCBI	Hsf2bp
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Meilb2; 4932437G14Rik
Lieferbar
Background	Involved in meiosis I and spermatogenesis. Located in chromosome. Is expressed in several structures, including genitourinary system; nervous system; sensory organ; surface ectoderm; and thymus. Human ortholog(s) of this gene implicated in primary ovarian insufficiency 19. Orthologous to human HSF2BP (heat shock transcription factor 2 binding protein).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of mouse HSF2BP (NP_083178.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:200
Protein Size	37kDa
Manufacturers Research Area	Signal Transduction
Gene Symbol	Hsf2bp

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 uL

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail