« Zurück
Home /
NEPRO Rabbit pAb

NEPRO Rabbit pAb

ArtNr	A10520-500uL
Hersteller	Abclonal
Menge	500 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Mouse
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	EQLPKMNEDTLDRLSKPSEQMTSNPQSTVDLGQPVKACKRTRKEKPLGFDLRAFCTRLGNKATQETNRDFKYSQSKLKTTKLPSQQLRTHWANDTVQRIRKTKTFAQLSEEIEMAIVWSRSKKLKTQATFLGNKLLKSNRFRHVESQGYSLTKKLQCMKTSLCNCLLRGSRTSTSEHPPRQRRSKYKVLSRQRKPQRKLQSTLLKETQQVPEGTLKNTRDSSAKRRCSGTVQRSDVCPNGKQVLRKLAKPDLKTK
NCBI	Nepro
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NEPRO;C3orf17;NET17;bc027231
Lieferbar
Background	Acts upstream of or within negative regulation of neuron differentiation and positive regulation of Notch signaling pathway. Located in nucleolus. Is expressed in several structures, including adipose tissue; alimentary system; genitourinary system; integumental system; and nervous system. Human ortholog(s) of this gene implicated in anauxetic dysplasia 3. Orthologous to human NEPRO (nucleolus and neural progenitor protein).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 263-564 of mouse NEPRO (NP_666084.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	63kDa
Manufacturers Research Area	Cell Biology & Developmental Biology
Gene Symbol	Nepro

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 18 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail