Description |
Product Name: RAR-Related Orphan Receptor C Human Recombinant Synonyms: Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, Retinoid-related orphan receptor-gamma, RORC, NR1F3, RORG, RZRG, TOR, RZR-GAMMA. Description: RAR-Related Orphan Receptor C Human Recombinant produced in E.Coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag.RORC is purified by proprietary chromatographic techniques. Uniprot Accesion Number: P51449 Amino Acid Sequence:MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEFMRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK. Source: Escherichia Coli. Physical Appearance and Stability: Store at 4C if entire vial will be used within 2-4 weeks.Store, frozen at -20C for longer periods of time.Please avoid freeze thaw cycles. Formulation and Purity: RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5. Greater than 80.0% as determined by SDS-PAGE. Shipping Format and Condition: Lyophilized powder at room temperature. Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |