« Zurück
Home /
β-Amyloid A4 Protein Precursor (740-770), APP (C31) - 1 mg

β-Amyloid A4 Protein Precursor (740-770), APP (C31) - 1 mg

ArtNr	AS-62073
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding By Cell Type Peptides & Proteins Adenocarcinoma Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH
Citations	Chen, Y. et al. J. Cell Biol. 163, 27 (2003); Lu, D. et al. Nat. Med. 6, 397 (2000).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3717.3
Description	This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Product Group	LB1A1Z
Research Area	Neuroscience / Lyophilized
Sequence One-Letter Code	AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
GTIN	5400535149918
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

AS-62073-safety-datasheet.pdf