« Zurück
Home /
Recombinant Mouse B7-1/CD80 Protein

Recombinant Mouse B7-1/CD80 Protein

ArtNr	RP01233-20ug
Hersteller	Abclonal
Menge	20 ug
Kategorie	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse
Host	Mouse
Purity	> 97% by SDS-PAGE.
Sequence	VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK
NCBI	B7-1/CD8
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	B7, B7-1, B7.1, BB1, CD28LG, CD28LG1, LAB7
Similar products	BB1, B7, B7, B7-1, B7.1, CD28LG, CD28LG1, LAB7
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	The protein is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.
Route	C-hFc&His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Val38-Lys245
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Immune Checkpoint, Bio-Markers & CD Antigens
Gene Symbol	B7-1/CD80
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Mouse B7-1/CD80 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val38-Lys245) of mouse B7-1/CD80 (Accession #NP_033985.3) fused with a Fc, 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse CD80 at 500 ng/mL (100 μL/well) can bind Recombinant Human CTLA-4 with a linear range of 11-44 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail