ArtNr |
RP01154-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Host |
Human |
Purity |
> 82% by SDS-PAGE. |
Sequence |
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
NCBI |
IL-12A |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CLMF, IL-12A, NFSK, NKSF1, P35 |
Similar products |
P35, CLMF, IL-12A, NFSK, NKSF1 |
Lieferbar |
|
Description |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Background |
Interleukin-12 subunit alpha (IL12A/IL-12p35) is also known as Cytotoxic lymphocyte maturation factor 35 kDa subunit, cytotoxic lymphocyte maturation factor 1, p35, NK cell stimulatory factor chain 1, and interleukin-12 alpha chain. IL12A/IL-12p35 is a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. |
Route |
C-Flag |
Manufacturers Category |
Proteins |
Immunogen |
Arg23-Ser219 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Interleukin, Cell Culture related, Biosimilar Drug Targets |
Gene Symbol |
IL-12A |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Human IL-12A Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg23-Ser219) of human IL12A/NKSF1 (Accession #NP_000873.2) fused with a Flag tag at the C-terminus. |
Protein Bio Activity |
Measured in a cell proliferation assay using anti-CD3 antibody activated Jurkat Human acute T lymphocyte leukemia cells. The ED50 for this effect is typically 0.075-0.3 ng/mL. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.