Vergleich

Recombinant Human EphA3 Protein Europäischer Partner

ArtNr RP00985-50ug
Hersteller Abclonal
Menge 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human
Host Human
Purity > 95% by SDS-PAGE.
Sequence MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIG
NCBI EphA3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EK4, ETK , ETK1, HEK , HEK4, TYRO4
Similar products EK4, ETK, ETK1, HEK, HEK4, TYRO4
Lieferbar
Description
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
EphA3, also known as Cek4, Mek4, Hek, Tyro4, and Hek4, is a 135 kDa glycosylated member of the transmembrane Eph receptor tyrosine kinase family. EphA3 is expressed in the developing forebrain, retinal axons, some spinal cord motor neurons, and the heart where it plays an important role in axonal repulsion and organ morphogenesis. It is upregulated on some hematopoietic and solid tumor cells and on astrocytes surrounding injured nervous tissue . EphA3 ligation inhibits cellular adhesion to fibronectin as well as cellular migration. Transmembrane EphA3 associates in cis with ADAM10 which then promotes the cleavage in trans of Ephrin-A5. It also associates in cis with Ephrin-A5 on retinal axons, thereby preventing the activation of EphA3 by Ephrin-A.
Route
C-His
Manufacturers Category
Proteins
Endotoxin
< 1.0 EU/μg of the protein by LAL method.
Immunogen
Met1-Gln541
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area
Biosimilar Drug Targets
Gene Symbol
EphA3
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description
Recombinant Human EphA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln541) of human EphA3 (Accession #NP_005224.2) fused with a 6×His tag at the C-terminus.
Protein Bio Activity
Measured by its binding ability in a functional ELISA. Immobilized Human EFNA5 at 0.5 μg/mL (100 μL/well) can bind Human EPHA3 with a linear range of 0.01-0.3 ng/mL.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen