ArtNr |
RP00985-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Host |
Human |
Purity |
> 95% by SDS-PAGE. |
Sequence |
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIG |
NCBI |
EphA3 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
EK4, ETK , ETK1, HEK , HEK4, TYRO4 |
Similar products |
EK4, ETK, ETK1, HEK, HEK4, TYRO4 |
Lieferbar |
|
Description |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Background |
EphA3, also known as Cek4, Mek4, Hek, Tyro4, and Hek4, is a 135 kDa glycosylated member of the transmembrane Eph receptor tyrosine kinase family. EphA3 is expressed in the developing forebrain, retinal axons, some spinal cord motor neurons, and the heart where it plays an important role in axonal repulsion and organ morphogenesis. It is upregulated on some hematopoietic and solid tumor cells and on astrocytes surrounding injured nervous tissue . EphA3 ligation inhibits cellular adhesion to fibronectin as well as cellular migration. Transmembrane EphA3 associates in cis with ADAM10 which then promotes the cleavage in trans of Ephrin-A5. It also associates in cis with Ephrin-A5 on retinal axons, thereby preventing the activation of EphA3 by Ephrin-A. |
Route |
C-His |
Manufacturers Category |
Proteins |
Endotoxin |
< 1.0 EU/μg of the protein by LAL method. |
Immunogen |
Met1-Gln541 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Biosimilar Drug Targets |
Gene Symbol |
EphA3 |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Human EphA3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gln541) of human EphA3 (Accession #NP_005224.2) fused with a 6×His tag at the C-terminus. |
Protein Bio Activity |
Measured by its binding ability in a functional ELISA. Immobilized Human EFNA5 at 0.5 μg/mL (100 μL/well) can bind Human EPHA3 with a linear range of 0.01-0.3 ng/mL. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.