ArtNr |
RP00905-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Host |
Human |
Purity |
> 95% by SDS-PAGE. |
Sequence |
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
NCBI |
IL-22 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Interleukin-22, IL-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible factor, IL-TIF, IL22, ILTIF, ZCYTO18 |
Similar products |
IL22, IL-22, ILTIF, ZCYTO18, Interleukin-22, Cytokine Zcyto18, IL-10-related T-cell-derived-inducible factor, IL-TIF |
Lieferbar |
|
Description |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Route |
No tag |
Manufacturers Category |
Proteins |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Immunogen |
Ala34-Ile179 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Interleukin, Biosimilar Drug Targets |
Gene Symbol |
IL-22 |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Human IL-22 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala34-Ile179) of human IL-22 (Accession #Q9GZX6) fused with an initial Met at the N-terminus. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.