« Zurück
Home /
Recombinant Human β-NGF Protein

Recombinant Human β-NGF Protein

ArtNr	RP00428-1000ug
Hersteller	Abclonal
Menge	1000 ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
NCBI	Beta-NGF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-NGF, HSAN5, NGFB
Similar products	NGFB, Beta-NGF, HSAN5
Lieferbar
Description	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	This protein is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in This protein have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of This protein's expression is associated with allergic rhinitis.
Route	No tag
Manufacturers Category	Proteins
Endotoxin	< 1 EU/μg of the protein by LAL method.
Immunogen	Ser122-Ala241
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Growth Factor, Cell Culture related, Biosimilar Drug Targets
Gene Symbol	Beta-NGF
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 250 mM NaCl, pH 7.0.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Beta-NGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser122-Ala241) of human β-NGF (Accession #P01138).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 30 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail