ArtNr |
RP00282-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Host |
Human |
Purity |
> 90% by SDS-PAGE. |
Sequence |
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE |
NCBI |
TNFRSF1B/DR5/TRAIL-R2/CD262 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CD262 Protein, Human, DR5 Protein, Human, KILLER Protein, Human, KILLER/DR5 Protein, Human, TRAIL-R2 Protein, Human, TRAILR2 Protein, Human, TRICK2 Protein, Human, TRICK2A Protein, Human, TRICK2B Protein, Human, TRICKB Protein, Human, ZTNFR9 Protein, Human |
Similar products |
Human, CD262 Protein, DR5 Protein, KILLER Protein, KILLER/DR5 Protein, TRAIL-R2 Protein, TRAILR2 Protein, TRICK2 Protein, TRICK2A Protein, TRICK2B Protein, TRICKB Protein, ZTNFR9 Protein |
Lieferbar |
|
Description |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Background |
This protein is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. |
Route |
C-His |
Manufacturers Category |
Proteins |
Endotoxin |
< 0.1 EU/μg of the protein by LAL method. |
Immunogen |
Ile56-Glu182 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Bio-Markers & CD Antigens, TNF family, Biosimilar Drug Targets |
Gene Symbol |
TNFRSF10B/DR5/TRAIL-R2/CD262 |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation. |
Protein Description |
Active Recombinant Human TNFRSF10B/DR5/TRAIL-R2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ile 56 - Glu 182) of human DR5 (Accession #NP_003833.3) fused with a 6×His tag at the C-terminus. |
Protein Bio Activity |
1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human TRAIL at 2 μg/mL (100 μL/well) can bind Recombinant Human DR5 with a linear range of 14-56 ng/mL.|2.Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 0.38-1.5 pg/mL in the presence of 20 ng/mL Recombinant Human TRAIL/TNFSF10.|3.Measured by its binding ability in a functional ELISA.Immobilized Human TRAIL / TNFSF10 Protein at 2μg/mL (100 μL/well) can bind Human CD262 Protein with a linear range of 0.5-14.1 ng/mL. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.