« Zurück
Home /
Recombinant Human THSD1 Protein

Recombinant Human THSD1 Protein

ArtNr	RP00253-50ug
Hersteller	Abclonal
Menge	50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAP
NCBI	THSD1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	TMTSP, UNQ3010
Similar products	TMTSP, UNQ3010
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Human Thrombospondin type-1 domain-containing protein 1 (THSD1) also known as Transmembrane molecule with thrombospondin module (TMTSP), is a single-pass type I membrane protein. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1’s ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Glu25-Ile361
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	THSD1
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human THSD1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu 25 - Ile 361 ) of human THSD1 (Accession #NP_954872.1) fused with a 6×His tag at the C-terminus.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 22 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail