« Zurück
Home /
Recombinant Human Cathepsin D/CTSD Protein

Recombinant Human Cathepsin D/CTSD Protein

ArtNr	RP00214-10ug
Hersteller	Abclonal
Menge	10 ug
Kategorie	Oncology Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis By Organ Breast Cancer Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	Human
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLD
NCBI	Cathepsin D
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CLN10, CPSD, HEL-S-130P
Similar products	CPSD, CLN10, HEL-S-130P
Lieferbar
Description	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background	Cathepsin D (CTSD), a well known lysosomal aspartyl protease and belongs to the peptidase C1 family. It is expressed in most cells and overexpressed in breast cancer cells. It is a major enzyme in protein degradation in lysosomes, and also involved in the presentation of antigenic peptides. cathepsin D is essential for proteolysis of proteins regulating cell growth and tissue homeostasis. CTSD secreted from human prostate carcinoma cells are responsible for the generation of angiostatin, a potent endogenous inhibitor of angiogenesis, suggesting its contribution to the prevention of tumor growth and angiogenesis-dependent growth of metastases.
Route	C-His
Manufacturers Category	Proteins
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Immunogen	Leu21-Leu412
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturers Research Area	Other Recombinant Protein
Gene Symbol	Cathepsin D
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Protein Description	Recombinant Human Cathepsin D Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu21-Leu412) of human Cathepsin D/CTSD (Accession #NP_001900.1) fused with a 6×His tag at the C-terminus.
Protein Bio Activity	Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is >747 pmol/min/μg.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 28 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail