ArtNr |
RP00019-100ug |
Hersteller |
Abclonal
|
Menge |
100 ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human |
Host |
Human |
Purity |
> 97% by SDS-PAGE. |
Sequence |
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
NCBI |
IL-33 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV |
Similar products |
C9orf26, IL1F11, DVS27, NF-HEV, NFEHEV |
Lieferbar |
|
Description |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Background |
Interleukin 33 (IL-33), also known as DVS27 or NF-HEV (Nuclear Factor from High Endothelial enules), is a proinflammatory protein and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. |
Route |
No tag |
Manufacturers Category |
Proteins |
Endotoxin |
< 0.1 EU/μg of the protein by LAL method. |
Immunogen |
Ser112-Thr270 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturers Research Area |
Interleukin, Biosimilar Drug Targets |
Gene Symbol |
IL-33 |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation. |
Protein Description |
Recombinant Human IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser112-Thr270) of human IL-33 (Accession #NP_001300973.1). |
Protein Bio Activity |
Measured by its binding ability in a functional ELISA. Immobilized Recombinant human IL33 at 10 μg/mL (100 μL/well) can bind Recombinant human IL1RL1 with a linear range of 37.8-151.4 ng/mL. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.