Vergleich

CREBBP Rabbit pAb Europäischer Partner

ArtNr A14237-200ul
Hersteller Abclonal
Menge 200ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Mouse
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGL
NCBI Crebbp
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CREBBP;CBP;KAT3A;RSTS;RSTS1
Lieferbar
Background
Enables several functions, including DNA-binding transcription factor binding activity; TFIIB-class transcription factor binding activity; and disordered domain specific binding activity. Involved in several processes, including cellular response to virus; face morphogenesis; and negative regulation of interferon-beta production. Acts upstream of or within cellular response to hepatocyte growth factor stimulus; germ-line stem cell population maintenance; and regulation of gene expression. Located in chromatin and nucleus. Part of RNA polymerase II transcription regulator complex; histone acetyltransferase complex; and outer kinetochore. Is expressed in several structures, including alimentary system; embryo ectoderm; genitourinary system; heart; and skin. Used to study Rubinstein-Taybi syndrome; acute myeloid leukemia; autism spectrum disorder; and myelodysplastic syndrome. Human ortholog(s) of this gene implicated in Rubinstein-Taybi syndrome; acute lymphoblastic leukemia; and acute myeloid leukemia. Orthologous to human CREBBP (CREB binding protein).
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-445 of mouse CREBBP (NP_001020603.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
265kDa
Manufacturers Research Area
Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, Acetylation, Transcription Factors, Nuclear Receptor Signaling, Cancer, Signal Transduction, Cell Biology & Developmental Biology, TGF-b-Smad Signaling Pathway, Notch Signaling Pathway, Wnt/β-Catenin Signaling Pathway, Endocrine & Metabolism, Mitochondrial metabolism, Lipid Metabolism, Immunology & Inflammation, NF-kB Signaling Pathway, Neuroscience, Neurodegenerative Diseases, Stem Cells, Cardiovascular, Angiogenesis, Binding factor, Binding factor
Gene Symbol
Crebbp

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200ul
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 27.09.2024 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen