« Zurück
Home /
CREBBP Rabbit pAb

CREBBP Rabbit pAb

ArtNr	A14237-200ul
Hersteller	Abclonal
Menge	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Neural Signaling Antibodies By Cell Type Hematology Lymphoma Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGL
NCBI	Crebbp
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CBP, KAT3A, CBP/p300, p300/CBP, CREBBP
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	Enables several functions, including DNA-binding transcription factor binding activity; TFIIB-class transcription factor binding activity; and disordered domain specific binding activity. Involved in several processes, including cellular response to virus; face morphogenesis; and negative regulation of interferon-beta production. Acts upstream of or within cellular response to hepatocyte growth factor stimulus; germ-line stem cell population maintenance; and regulation of gene expression. Located in chromatin and nucleus. Part of RNA polymerase II transcription regulator complex; histone acetyltransferase complex; and outer kinetochore. Is expressed in several structures, including alimentary system; embryo ectoderm; genitourinary system; heart; and skin. Used to study Rubinstein-Taybi syndrome; acute myeloid leukemia; autism spectrum disorder; and myelodysplastic syndrome. Human ortholog(s) of this gene implicated in Rubinstein-Taybi syndrome; acute lymphoblastic leukemia; and acute myeloid leukemia. Orthologous to human CREBBP (CREB binding protein).
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-445 of mouse CREBBP (NP_001020603.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	265kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, Acetylation, Transcription Factors, Nuclear Receptor Signaling, Cancer, Signal Transduction, Cell Biology & Developmental Biology, TGF-b-Smad Signaling Pathway, Notch Signaling Pathway, Wnt/β-Catenin Signaling Pathway, Endocrine & Metabolism, Mitochondrial metabolism, Lipid Metabolism, Immunology & Inflammation, NF-kB Signaling Pathway, Neuroscience, Neurodegenerative Diseases, Stem Cells, Cardiovascular, Angiogenesis, Binding factor, Binding factor

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ul

lieferbar

Lieferung vsl. bis 31.07.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail