« Zurück
Home /
CPSF6 Rabbit pAb

CPSF6 Rabbit pAb

ArtNr	A5963-50ul
Hersteller	Abclonal
Menge	50ul
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, IP, ICC, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPP
NCBI	CPSF6
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CPSF6;CFIM;CFIM68;HPBRII-4;HPBRII-7;CFIM72
Similar products	CFIM68, CFIM, HPBRII-4, HPBRII-7
Lieferbar
Background	The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human CPSF6 (NP_008938.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:1000 - 1:3000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200\|IP, 1:500 - 1:1000
Protein Size	59kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, RNA Binding
Gene Symbol	CPSF6

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 24 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail