« Zurück
Home /
CTSK Rabbit pAb

CTSK Rabbit pAb

ArtNr	A5871-100ul
Hersteller	Abclonal
Menge	100ul
Kategorie	Oncology Antibodies Cell Biology Cell Status Apoptosis Immunohistochemistry Western Blot Primary Antibodies By Organ Breast Cancer Testicular & Prostate Cancer Uterine, Ovarian & Cervical Cancer
Typ	Antibody Polyclonal
Applikationen	WB, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
NCBI	CTSK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CTSK;CTS02;CTSO;CTSO1;CTSO2;PKND;PYCD
Similar products	Cathepsin K
Lieferbar
Background	The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 115-329 of human CTSK (NP_000387.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:100 - 1:500\|IHC-P, 1:100 - 1:200
Protein Size	37kDa
Manufacturers Research Area	Cancer, Invasion and Metastasis, Signal Transduction, Cell Biology Developmental Biology, Cell Adhesion, Cytoskeleton, Extracellular Matrix, Ubiquitin, Neuroscience, Cardiovascular, Angiogenesis
Gene Symbol	CTSK

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail