ArtNr |
A3237-50ul |
Hersteller |
Abclonal
|
Menge |
50ul |
Kategorie |
|
Typ |
Antibody Polyclonal |
Applikationen |
WB, ELISA, IHC-P |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSP |
NCBI |
TWIST1 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
TWIST1;ACS3;BPES2;BPES3;CRS;CRS1;CSO;SCS;TWIST;bHLHa38 |
Lieferbar |
|
Background |
This gene encodes a basic helix-loop-helix (bHLH) transcription factor that plays an important role in embryonic development. The encoded protein forms both homodimers and heterodimers that bind to DNA E box sequences and regulate the transcription of genes involved in cranial suture closure during skull development. This protein may also regulate neural tube closure, limb development and brown fat metabolism. This gene is hypermethylated and overexpressed in multiple human cancers, and the encoded protein promotes tumor cell invasion and metastasis, as well as metastatic recurrence. Mutations in this gene cause Saethre-Chotzen syndrome in human patients, which is characterized by craniosynostosis, ptosis and hypertelorism. |
Route |
Recombinant protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of Twist (NP_000465.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:100 - 1:500|IHC-P, 1:50 - 1:200 |
Protein Size |
21kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Transcription Factors, Cancer, Cell Biology Developmental Biology, Neuroscience, Cell Type Marker, Stem Cells, Cardiovascular, Heart, Cardiogenesis, Neuron marker |
Gene Symbol |
TWIST1 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.