« Zurück
Home /
LEPREL2 Rabbit pAb

LEPREL2 Rabbit pAb

ArtNr	A2293-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Oncology Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Antibodies Obesity Western Blot Endocrine Regulation of Lipid Metabolism Primary Antibodies By Organ Breast Cancer
Typ	Antibody Polyclonal
Applikationen	ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	DAAGAGARSGYRGRRSPHTPHERFEGLTVLKAAQLARAGTVGSQGAKLLLEVSERVRTLTQAYFSPERPLHLSFTHLVCRSAIEGEQEQRMDLSHPVHADNCVLDPDTGECWREPPAYTYRDYSGLLYLNDDFQGGDLFFTEPNALTVTARVRPRCGRLVAFSSGVENPHGVWAVTRGRRCALALWHTWAPEHREQEWIEAKELLQESQEEEEEEEEEMPSKDPSPEPPSRRHQRVQDKTGRAPRVREEL
NCBI	P3H3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P3H3;GRCB;HSU47926;LEPREL2
Similar products	LEPREL2
Lieferbar
Background	The protein encoded by this gene belongs to the leprecan family of proteoglycans, which function as collagen prolyl hydroxylases that are required for proper collagen biosynthesis, folding and assembly. This protein, like other family members, is thought to reside in the endoplasmic reticulum. Epigenetic inactivation of this gene is associated with breast and other cancers, suggesting that it may function as a tumor suppressor.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 487-736 of human LEPREL2 (NP_055077.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Size	82kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Cancer, Tumor suppressors, Signal Transduction, Cell Biology Developmental Biology, Cytoskeleton, Extracellular Matrix
Gene Symbol	P3H3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 17 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail