ArtNr |
A2145-20ul |
Hersteller |
Abclonal
|
Menge |
20ul |
Kategorie |
|
Typ |
Antibody Polyclonal |
Applikationen |
WB, IF, ICC, ELISA |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEY |
NCBI |
CHEK2 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
CDS1;CHK2;HuCds1;LFS2;PP1425;RAD53;hCds1;CHEK2;Chk2 |
Lieferbar |
|
Background |
In response to DNA damage and replication blocks, cell cycle progression is halted through the control of critical cell cycle regulators. The protein encoded by this gene is a cell cycle checkpoint regulator and putative tumor suppressor. It contains a forkhead-associated protein interaction domain essential for activation in response to DNA damage and is rapidly phosphorylated in response to replication blocks and DNA damage. When activated, the encoded protein is known to inhibit CDC25C phosphatase, preventing entry into mitosis, and has been shown to stabilize the tumor suppressor protein p53, leading to cell cycle arrest in G1. In addition, this protein interacts with and phosphorylates BRCA1, allowing BRCA1 to restore survival after DNA damage. Mutations in this gene have been linked with Li-Fraumeni syndrome, a highly penetrant familial cancer phenotype usually associated with inherited mutations in TP53. Also, mutations in this gene are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors. This nuclear protein is a member of the CDS1 subfamily of serine/threonine protein kinases. Several transcript variants encoding different isoforms have been found for this gene. |
Route |
Recombinant protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human Chk2 (NP_009125.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:100 - 1:500|IF/ICC, 1:50 - 1:200 |
Protein Size |
61kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, DNA Damage Repair, Protein phosphorylation, Cancer, Signal Transduction, Kinase, Serine threonine kinases, ATM Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Cell Cycle, Cell Cycle Control-G1 S Checkpoint, Cell Cycle Control-G2 M DNA Damage Checkpoint |
Gene Symbol |
CHEK2 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.