ArtNr |
A16287-20ul |
Hersteller |
Abclonal
|
Menge |
20ul |
Kategorie |
|
Typ |
Antibody Polyclonal |
Applikationen |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT |
NCBI |
VHL |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
VHL;HRCA1;RCA1;VHL1;pVHL;PVHL |
Lieferbar |
|
Background |
This gene encodes a component of a ubiquitination complex. The encoded protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. In addition to oxygen-related gene expression, this protein plays a role in many other cellular processes including cilia formation, cytokine signaling, regulation of senescence, and formation of the extracellular matrix. Variants of this gene are associated with von Hippel-Lindau syndrome, pheochromocytoma, erythrocytosis, renal cell carcinoma, and cerebellar hemangioblastoma. |
Route |
Synthetic peptide |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VHL (NP_937799.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
24kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Cancer, Tumor suppressors, Cell Biology Developmental Biology, Apoptosis, Cell Cycle, Cell cycle inhibitors, Cell differentiation, Ubiquitin, Ubiquitin-Proteasome Signaling Pathway, Endocrine Metabolism, Immunology Inflammation, Cardiovascular, Angiogenesis |
Gene Symbol |
VHL |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.