« Zurück
Home /
GSTT2 Rabbit pAb

GSTT2 Rabbit pAb

ArtNr	A15678-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
NCBI	GSTT2
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GSTT2
Lieferbar
Background	The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations.
Route	Recombinant Protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-244 of human GSTT2 (NP_000845.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	28kDa
Gene Symbol	GSTT2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 31 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail